PIG3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PIG3 Polyclonal antibody (14828-1-AP)

PIG3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14828-1-AP Copied!

Publications (5)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA
For FC, select conjugated version.

Synonyms

TP53I3, EC:1.6.5.5, NADPH:quinone reductase PIG3, p53 induced gene 3 protein, p53-induced gene 3 protein

• 

  WB analysis of HeLa using 14828-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SMMC-7721 using 14828-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 14828-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 14828-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14828-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 14828-1-AP

  IP result of anti-PIG3 (IP:14828-1-AP, 4ug; Detection:14828-1-AP 1:500) with MCF-7 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 14828-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14828-1-AP (PIG3 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 14828-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14828-1-AP (PIG3 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14828-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PIG3 antibody (14828-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PIG3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, SMMC-7721 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14828-1-AP targets PIG3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6618

  Product name: Recombinant human TP53I3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC000474

  Sequence: MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

• Full Name: tumor protein p53 inducible protein 3
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 34-36 kDa
• GenBank Accession Number: BC000474
• Gene Symbol: TP53I3
• Gene ID (NCBI): 9540
• RRID: AB_2206893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53FA7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PIG3 (TP53I3) Polyclonal antibody (Cat# 14828-1-AP) has 5 total citations. These appear in Biomaterials, Cell Death Discovery, Cancers (Basel), Virology, and Oncology Letters. The associated research fields span breast cancer chemoresistance and macrophage re-education, oxidative stress homeostasis in trophoblasts, non-small-cell lung cancer prognosis, virus-induced apoptosis, and liver cancer molecular subtyping. Citations primarily use WB and IF applications in human samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Biomaterials; Furin-instructed aggregated gold nanoparticles for re-educating tumor associated macrophages and overcoming breast cancer chemoresistance.; Authors - Rou Xie
	WB	Cell Death Discov; DCTPP1 regulates oxidative stress homeostasis via AUF1 in human villous trophoblasts; Authors - Yajuan Lu
human	WB	Cancers (Basel); A TP53-Pathway-Based Prognostic Signature for Radiotherapy and Functional Validation of TP53I3 in Non-Small-Cell Lung Cancer.; Authors - Xiang Huang ; KD Validated
human	WB	Virology; VP5 protein of oncolytic herpes simplex virus type 2 induces apoptosis in A549 cells through TP53I3 protein; Authors - Yang Wang
human	WB	Oncol Lett; Prognostic prediction signature and molecular subtype for liver cancer: A CTC/CTM‑related gene prediction model and independent external validation; Authors - Ling Xu

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The single review for this antibody reports excellent performance in Western Blot using U2OS cancer cell lines at a 1:1000 dilution. The reviewer rated it 4 out of 5 stars, noting strong band intensity and correct molecular weight, and described the product as highly recommended for WB applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

IGNACIO (Verified Customer) (10-22-2021)

The antibody works perfect for WB with strong bands. The size is correct. Highly recommended.

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: U2OS cancer cell lines