PIG3 Polyclonal antibody

• 

  WB analysis of HeLa using 14828-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14828-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SMMC-7721 using 14828-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 14828-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14828-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14828-1-AP (PIG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 14828-1-AP

  IP result of anti-PIG3 (IP:14828-1-AP, 4ug; Detection:14828-1-AP 1:500) with MCF-7 cells lysate 3200ug.

• 

  IHC staining of human liver cancer using 14828-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14828-1-AP (PIG3 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14828-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14828-1-AP (PIG3 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 14828-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PIG3 antibody (14828-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

PIG3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14828-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TP53I3, Quinone oxidoreductase PIG3, p53-induced gene 3 protein, p53 induced gene 3 protein, NADPH:quinone reductase PIG3

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, SMMC-7721 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

14828-1-AP targets PIG3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6618

  Product name: Recombinant human TP53I3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC000474

  Sequence: MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

• Full Name: tumor protein p53 inducible protein 3
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 34-36 kDa
• GenBank Accession Number: BC000474
• Gene Symbol: TP53I3
• Gene ID (NCBI): 9540
• RRID: AB_2206893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53FA7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Biomaterials; Furin-instructed aggregated gold nanoparticles for re-educating tumor associated macrophages and overcoming breast cancer chemoresistance.; Authors - Rou Xie
human	WB	Virology; VP5 protein of oncolytic herpes simplex virus type 2 induces apoptosis in A549 cells through TP53I3 protein; Authors - Yang Wang
human	WB	Oncol Lett; Prognostic prediction signature and molecular subtype for liver cancer: A CTC/CTM‑related gene prediction model and independent external validation; Authors - Ling Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

IGNACIO (Verified Customer) (10-22-2021)

The antibody works perfect for WB with strong bands. The size is correct. Highly recommended.

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: U2OS cancer cell lines