• KD/KO Validated

CoraLite® Plus 488-conjugated TPD52L2 Monoclonal antibody

TPD52L2 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-68077
Clone No.3B3C6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

TPD54, 3B3C6, Tumor protein D52-like 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHCT 116 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68077 targets TPD52L2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30863

Product name: Recombinant human TPD52L2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-201 aa of BC006804

Sequence: MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLS

Predict reactive species
Full Name tumor protein D52-like 2
Calculated Molecular Weight 206 aa, 22 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC006804
Gene Symbol TPD52L2
Gene ID (NCBI) 7165
RRIDAB_2923878
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43399
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Tumor protein D52-like proteins (TPD52) are small coiled-coil motif bearing proteins that were first identified in breast carcinoma. Three human TPD52 members had been identified, named hD52 (TPD52), hD53 (TPD52L1), and hD54 (TPD52L2). The most important characteristic of the protein family is a highly conserved coiled-coil motif that is required for homo- and heteromeric interaction with other TPD52-like proteins. TPD52 and related proteins have been implicated in cell proliferation, apoptosis, and vesicle trafficking. TPD52L2 has five isoforms produced by alternative splicing, and its multiple sites have been identified to be phosphorylated. Interaction of TPD52L2 with MAL2, a novel member of the MAL proteolipid family, may be required for the role of TPD52L2 in vesicle transport.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TPD52L2 antibody CL488-68077Download protocol
IF protocol for CL Plus 488 TPD52L2 antibody CL488-68077Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...