TPH1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TPH1 Polyclonal antibody, PBS Only (29904-1-PBS)

• 

  WB analysis using 29904-1-AP (same clone as 29904-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29904-1-AP (TPH1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29904-1-AP (same clone as 29904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29904-1-AP (TPH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29904-1-AP (same clone as 29904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29904-1-AP (TPH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29904-1-PBS in a different storage buffer formulation.

TPH1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29904-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:1.14.16.4, TPH, TPH 1, TPRH, TRPH

---

Product Information

29904-1-PBS targets TPH1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31623

  Product name: Recombinant human TPH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 385-444 aa of BC106739

  Sequence: KMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI

• Full Name: tryptophan hydroxylase 1
• Calculated Molecular Weight: 466 aa, 53 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC106739
• Gene Symbol: TPH1
• Gene ID (NCBI): 7166
• RRID: AB_3742319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17752
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tryptophan hydroxylase 1 (TPH1) is the rate-limiting enzyme in the synthesis of serotonin (5-HT) from the amino acid tryptophan. It is primarily found in peripheral tissues such as the gut, pineal gland, and spleen. TPH1 plays a crucial role in regulating peripheral serotonin levels, which are involved in various physiological processes including gastrointestinal motility and cardiovascular function. Additionally, TPH1 has been implicated in the regulation of blood glucose levels and is associated with conditions such as fatty liver disease. (PMID: 32590025, PMID: 36331742, PMID: 37652099)