Tested Applications
| Positive WB detected in | rat brain tissue, mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
29283-1-AP targets TPH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30281 Product name: Recombinant human TPH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 440-496 aa of BC114442 Sequence: DFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLGI Predict reactive species |
| Full Name | tryptophan hydroxylase 2 |
| Calculated Molecular Weight | 490 aa, 56 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC114442 |
| Gene Symbol | TPH2 |
| Gene ID (NCBI) | 121278 |
| RRID | AB_3742307 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IWU9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TPH2 protein is a key enzyme in the synthesis of serotonin in the brain. It is mainly expressed in the brain and is responsible for converting tryptophan to 5-hydroxytryptophan, a precursor of serotonin. TPH2 plays a crucial role in regulating mood, anxiety, and stress responses. Variations in the TPH2 gene have been associated with several psychiatric disorders, including depression and bipolar disorder. Additionally, TPH2 expression can be regulated by various factors, such as hormones and environmental stimuli (PMID: 22241550, PMID: 29775696, PMID: 32119710, PMID: 40204433).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TPH2 antibody 29283-1-AP | Download protocol |
| WB protocol for TPH2 antibody 29283-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Lipid Res Tryptophan and polyamine metabolism dysregulation serves as an early marker of high-fat diet-induced glucose intolerance. | ||
Food Res Int Ligilactobacillus murinus alleviates binge-eating behavior by restoring serotonin metabolism. |
