Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, HeLa cells, rat skeletal muscle tissue |
| Positive IHC detected in | human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13741-1-AP targets TPM4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4679 Product name: Recombinant human TPM4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC037576 Sequence: MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI Predict reactive species |
| Full Name | tropomyosin 4 |
| Calculated Molecular Weight | 248 aa, 29 kDa |
| Observed Molecular Weight | 32-35 kDa |
| GenBank Accession Number | BC037576 |
| Gene Symbol | TPM4 |
| Gene ID (NCBI) | 7171 |
| ENSEMBL Gene ID | ENSG00000167460 |
| RRID | AB_2205772 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P67936 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TPM4, also named as TM30p1, Tropomyosin 4, Tropomyosin alpha 4 chain. This gene is one gene type of tropomyosin isoforms and encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is a major regulatory protein of cytoskeleton and is localized along actin filaments modulating the interaction of actin and myosin (PubMed: 26315888, PubMed: 32638329). In addition, TPM4 has been reported as an oncoprotein in several malignancies (PubMed: 37459535). The calculated molecular weight of TPM4 is usually approximately 28 kDa. It maybe have two isoforms: the short 30-kDa isoform (TPM4.2) and the long 38-kDa isoform (TPM4.1) (PubMed: 28134622).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TPM4 antibody 13741-1-AP | Download protocol |
| WB protocol for TPM4 antibody 13741-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TPM4 Polyclonal antibody (Cat# 13741-1-AP) has 5 total citations. These appear in Osteoporos Int, mSphere, Int J Med Sci, J Proteomics, and Onco Targets Ther. Research fields span osteoporosis and bone marrow microenvironment, intracellular infection and cytoskeleton regulation, hepatocellular carcinoma (expression, proliferation, and mTORC1 signaling), and brain proteomics in glutaminase-deficient mice. Applications cited include WB and IHC in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Osteoporos Int Differentially expressed proteins identified by TMT proteomics analysis in bone marrow microenvironment of osteoporotic patients. | ||
mSphere Ehrlichia chaffeensis TRP75 Interacts with Host Cell Targets Involved in Homeostasis, Cytoskeleton Organization, and Apoptosis Regulation To Promote Infection. | ||
Int J Med Sci The expression and clinical significance of TPM4 in hepatocellular carcinoma. | ||
Onco Targets Ther WHSC1 Promotes Cell Proliferation, Migration, and Invasion in Hepatocellular Carcinoma by Activating mTORC1 Signaling. |
Reviews
What customers say
The single review for this antibody (lot 00005276) rates it 4 out of 5 stars. The user tested it on NRVCMs at a 1:1000 dilution across Western Blot, Immunohistochemistry, and Immunofluorescence. They found it performs well for Western Blot and decently for Immunofluorescence. Overall, the feedback is positive, indicating reliable performance for its primary applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marco (Verified Customer) (07-01-2024) | good for westernblot, decent for immunofluorescence
|
