TPM4 Polyclonal antibody

• 

  WB analysis using 13741-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13741-1-AP (TPM4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13741-1-AP

  WB result of TPM4 antibody (13741-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TPM4 transfected HeLa cells.

• 

  IHC staining of human endometrial cancer using 13741-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 13741-1-AP (TPM4 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human endometrial cancer using 13741-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 13741-1-AP (TPM4 antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

TPM4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13741-1-AP

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

TM30p1, TPM4, tropomyosin 4, Tropomyosin alpha 4 chain

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, HeLa cells, rat skeletal muscle tissue
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

13741-1-AP targets TPM4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4679

  Product name: Recombinant human TPM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-248 aa of BC037576

  Sequence: MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

• Full Name: tropomyosin 4
• Calculated Molecular Weight: 248 aa, 29 kDa
• Observed Molecular Weight: 32-35 kDa
• GenBank Accession Number: BC037576
• Gene Symbol: TPM4
• Gene ID (NCBI): 7171
• ENSEMBL Gene ID: ENSG00000167460
• RRID: AB_2205772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P67936
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TPM4, also named as TM30p1, Tropomyosin 4, Tropomyosin alpha 4 chain. This gene is one gene type of tropomyosin isoforms and encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is a major regulatory protein of cytoskeleton and is localized along actin filaments modulating the interaction of actin and myosin (PubMed: 26315888, PubMed: 32638329). In addition, TPM4 has been reported as an oncoprotein in several malignancies (PubMed: 37459535). The calculated molecular weight of TPM4 is usually approximately 28 kDa. It maybe have two isoforms: the short 30-kDa isoform (TPM4.2) and the long 38-kDa isoform (TPM4.1) (PubMed: 28134622).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Proteomics; Network of brain protein level changes in glutaminase deficient fetal mice.; Authors - Bae Narkhyun N
human	WB	Onco Targets Ther; WHSC1 Promotes Cell Proliferation, Migration, and Invasion in Hepatocellular Carcinoma by Activating mTORC1 Signaling.; Authors - Jingjing Dai
human	WB,IHC	Int J Med Sci; The expression and clinical significance of TPM4 in hepatocellular carcinoma.; Authors - Linjing Li
human	WB	mSphere; Ehrlichia chaffeensis TRP75 Interacts with Host Cell Targets Involved in Homeostasis, Cytoskeleton Organization, and Apoptosis Regulation To Promote Infection.; Authors - Tian Luo
human	WB	Osteoporos Int; Differentially expressed proteins identified by TMT proteomics analysis in bone marrow microenvironment of osteoporotic patients.; Authors - Q Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Marco (Verified Customer) (07-01-2024)

good for westernblot, decent for immunofluorescence

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: NRVCMs