TPPP Polyclonal antibody

• 

  WB analysis of MCF-7 using 25040-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25040-1-AP (TPPP Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 25040-1-AP

  WB result of TPPP antibody (25040-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-TPPP transfected SH-SY5Y cells.

• 

  WB analysis using 25040-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25040-1-AP (TPPP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 25040-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25040-1-AP (TPPP Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 25040-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25040-1-AP (TPPP Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 25040-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25040-1-AP (TPPP Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human breast cancer using 25040-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25040-1-AP (TPPP Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 25040-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25040-1-AP (TPPP Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of MCF-7 using 25040-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using TPPP antibody (25040-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

TPPP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25040-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

25 kDa brain specific protein, 25 kDa brain-specific protein, EC:3.6.5.-, p24, p25 alpha

---

Tested Applications

• Positive WB detected in: mouse brain tissue, MCF-7 cells, rat brain tissue
• Positive IHC detected in: human brain tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25040-1-AP targets TPPP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19159

  Product name: Recombinant human TPPP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC131506

  Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTD

• Full Name: tubulin polymerization promoting protein
• Calculated Molecular Weight: 219 aa, 24 kDa
• Observed Molecular Weight: 24-29 kDa
• GenBank Accession Number: BC131506
• Gene Symbol: TPPP
• Gene ID (NCBI): 11076
• RRID: AB_2879865
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94811
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.