TPRG1L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TPRG1L Polyclonal antibody, PBS Only (25663-1-PBS)

• 

  WB analysis using 25663-1-AP (same clone as 25663-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25663-1-AP (TPRG1L antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25663-1-PBS in a different storage buffer formulation.

TPRG1L Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25663-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25663-1-PBS targets TPRG1L in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22585

  Product name: Recombinant human TPRG1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of BC019034

  Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEREGFGIRIQWDKQSRPSFI

• Full Name: tumor protein p63 regulated 1-like
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC019034
• Gene Symbol: TPRG1L
• Gene ID (NCBI): 127262
• RRID: AB_3085813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T0D9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.