TPST2 Polyclonal antibody

TPST2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 11699-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IF, IHC, ELISA

TPST 2, TPST2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman liver tissue
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11699-1-AP targets TPST2 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2244

Product name: Recombinant human TPST2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-377 aa of BC017509

Sequence: MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS

Predict reactive species
Full Name tyrosylprotein sulfotransferase 2
Calculated Molecular Weight 377 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC017509
Gene Symbol TPST2
Gene ID (NCBI) 8459
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60704
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for TPST2 antibody 11699-1-APDownload protocol
WB protocol for TPST2 antibody 11699-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB, IF, IP

J Mol Biol

Heterodimers of Tyrosylprotein Sulfotrans-ferases suggest existence of a higher organization level of transferases in the membrane of the trans-Golgi apparatus.

Authors - Cristina Hartmann-Fatu
Loading...
||
New chat Able
正在加载,请稍候...