TRABD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRABD Polyclonal antibody (33633-1-AP)

• 

  WB analysis using 33633-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33633-1-AP (TRABD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 33633-1-AP

  IP result of anti-TRABD (IP:33633-1-AP, 4ug; Detection:33633-1-AP 1:1000) with HeLa cells lysate 920 ug.

TRABD Polyclonal Antibody for WB, IP, ELISA

Cat No. 33633-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

PP2447, Protein TTG2, TraB domain-containing protein, TTG2

---

Tested Applications

• Positive WB detected in: HeLa cells, human testis tissue, mouse brain tissue, rat brain tissue
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33633-1-AP targets TRABD in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40480

  Product name: Recombinant human TRABD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of BC093029

  Sequence: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMKLKRRRQRPNLPRTVTQLVAEDGSRVYVVGTAHFSD

• Full Name: TraB domain containing
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC093029
• Gene Symbol: TRABD
• Gene ID (NCBI): 80305
• RRID: AB_3743034
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H4I3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TraB domain-containing protein (TRABD) is also named TTG2. TRABD is a Tiki/TraB family protein that is highly expressed in the brains of patients with AD (PMID: 33446646). TRABD as a novel outer mitochondrial membrane protein. Depletion of TRABD in cells severely impairs mitochondrial respiration and ATP production, inhibits cell growth, increases reactive oxygen species levels (PMID: 40778267).