Tested Applications
| Positive IHC detected in | human tonsillitis tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells |
| Positive FC (Intra) detected in | Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26845-1-AP targets TRAF1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25397 Product name: Recombinant human TRAF1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 173-295 aa of BC024145 Sequence: QEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPA Predict reactive species |
| Full Name | TNF receptor-associated factor 1 |
| Calculated Molecular Weight | 416 aa, 46 kDa |
| GenBank Accession Number | BC024145 |
| Gene Symbol | TRAF1 |
| Gene ID (NCBI) | 7185 |
| RRID | AB_2880655 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13077 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TRAF1 antibody 26845-1-AP | Download protocol |
| FC protocol for TRAF1 antibody 26845-1-AP | Download protocol |
| IF protocol for TRAF1 antibody 26845-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TRAF1 Polyclonal Antibody (Cat# 26845-1-AP) has 11 total citations spanning journals including Nature Communications, Journal of Experimental & Clinical Cancer Research, Cancer Letters, European Journal of Pharmacology, International Immunopharmacology, Frontiers in Pharmacology, Journal of Cellular and Molecular Medicine, FEBS Journal, Dose Response, Biochemical and Biophysical Research Communications, and International Urology and Nephrology. Research fields encompass cancer biology, NF-κB signaling, inflammation, cardiovascular disease, and metabolic disorders.
| Species | Application | Title |
|---|---|---|
Nat Commun Systematic HOIP interactome profiling reveals critical roles of linear ubiquitination in tissue homeostasis | ||
J Exp Clin Cancer Res DNMT1-induced miR-378a-3p silencing promotes angiogenesis via the NF-κB signaling pathway by targeting TRAF1 in hepatocellular carcinoma | ||
Cancer Lett Up-regulation of OLR1 expression by TBC1D3 through activation of TNFα/NF-κB pathway promotes the migration of human breast cancer cells. | ||
Eur J Pharmacol Capsaicin attenuates DSS-induced IBD by suppressing macrophage M1 polarization via inhibition of the TRAF1/NF-κB pathway. | ||
Int Immunopharmacol Autoinducer-2 of Fusobacterium nucleatum promotes macrophage M1 polarization via TNFSF9/IL-1β signaling. | ||
Front Pharmacol Anthraquinone Emodin Inhibits Tumor Necrosis Factor Alpha-Induced Calcification of Human Aortic Valve Interstitial Cells via the NF-κB Pathway. |
