TRAF3IP2 Recombinant monoclonal antibody

• 

  WB analysis of MCF-7 using 87596-1-RR

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 87596-1-RR (TRAF3IP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 87596-1-RR

  A549 cells were subjected to SDS PAGE followed by western blot with 87596-1-RR (TRAF3IP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87596-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87596-1-RR against Human TRAF3IP2 were performed. The affinity constant is below 1 pM.

TRAF3IP2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87596-1-RR

Clone No.252775C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ACT1, Adapter protein CIKS, C6orf2, C6orf4, C6orf5

---

Tested Applications

• Positive WB detected in: MCF-7 cells, A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87596-1-RR targets TRAF3IP2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24840

  Product name: Recombinant human TRAF3IP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC002823

  Sequence: MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN

• Full Name: TRAF3 interacting protein 2
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC002823
• Gene Symbol: TRAF3IP2
• Gene ID (NCBI): 10758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43734
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.