TRAF5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRAF5 Polyclonal antibody (12868-1-AP)

• Featured Product
• KD/KO Validated

TRAF5 Polyclonal Antibody for WB, ELISA

Cat No. 12868-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

RING finger protein 84, RNF84, TRAF5

• 

  WB analysis of Jurkat using 12868-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12868-1-AP (TRAF5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 12868-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 12868-1-AP (TRAF5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12868-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12868-1-AP (TRAF5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 12868-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12868-1-AP (TRAF5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRAF5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, PC-3 cells, mouse pancreas tissue, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12868-1-AP targets TRAF5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3519

  Product name: Recombinant human TRAF5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 209-557 aa of BC029600

  Sequence: DEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL

• Full Name: TNF receptor-associated factor 5
• Calculated Molecular Weight: 557 aa, 64 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC029600
• Gene Symbol: TRAF5
• Gene ID (NCBI): 7188
• RRID: AB_2209712
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00463
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TRAF5 Polyclonal antibody (Cat# 12868-1-AP) has accumulated 14 citations published in journals such as Cancer Letters, Journal of Neuroinflammation, Inflammation Research, European Journal of Pharmacology, International Journal of Molecular Sciences, Journal of Cellular and Molecular Medicine, Medical Oncology, Biochimica et Biophysica Acta, FEBS Journal, International Journal of Medical Sciences, Translational Cancer Research, and Journal of Asthma. Associated research fields include oncology, neuroinflammation, cardiovascular disease, immunology, bone biology, and wound healing.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Lett; Up-regulation of OLR1 expression by TBC1D3 through activation of TNFα/NF-κB pathway promotes the migration of human breast cancer cells.; Authors - Bei Wang
mouse	WB	J Neuroinflammation; CD36 deletion prevents white matter injury by modulating microglia polarization through the Traf5-MAPK signal pathway; Authors - Xiaoxiang Hou
mouse	WB	Inflamm Res; PGC1α alleviates M1 macrophage polarization through dual regulation of succinate metabolism and TRAF5 expression to mitigate TLR4/NF-κB-driven inflammatory cascades and myocardial ischemia/reperfusion injury.; Authors - Jiajie Leng
mouse	WB,IHC	Eur J Pharmacol; TRAF5 protects against myocardial ischemia reperfusion injury via AKT signaling.; Authors - Weipan Xu ; KO Validated
human	WB	Int J Mol Sci; Exploring the Anti-Colorectal Cancer Mechanism of Norcantharidin Through TRAF5/NF-κB Pathway Regulation and Folate-Targeted Liposomal Delivery; Authors - Fanqin Zhang
human	WB	Med Oncol; DLC-1 induces mitochondrial apoptosis and epithelial mesenchymal transition arrest in nasopharyngeal carcinoma by targeting EGFR/Akt/NF-κB pathway.; Authors - Wei Huang