TRAF5 Polyclonal antibody

• 

  WB analysis of Jurkat using 12868-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12868-1-AP (TRAF5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 12868-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 12868-1-AP (TRAF5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12868-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12868-1-AP (TRAF5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 12868-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12868-1-AP (TRAF5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

TRAF5 Polyclonal Antibody for WB, ELISA

Cat No. 12868-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

RING finger protein 84, RNF84, TRAF5

---

Tested Applications

• Positive WB detected in: Jurkat cells, PC-3 cells, mouse pancreas tissue, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 12 publications below
• IHC: See 2 publications below

Product Information

12868-1-AP targets TRAF5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3519

  Product name: Recombinant human TRAF5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 209-557 aa of BC029600

  Sequence: DEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL

• Full Name: TNF receptor-associated factor 5
• Calculated Molecular Weight: 557 aa, 64 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC029600
• Gene Symbol: TRAF5
• Gene ID (NCBI): 7188
• RRID: AB_2209712
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00463
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Neuroinflammation; CD36 deletion prevents white matter injury by modulating microglia polarization through the Traf5-MAPK signal pathway; Authors - Xiaoxiang Hou
human	WB	Cancer Lett; Up-regulation of OLR1 expression by TBC1D3 through activation of TNFα/NF-κB pathway promotes the migration of human breast cancer cells.; Authors - Bei Wang
human	WB	Biochim Biophys Acta Mol Cell Res; IL-17 promotes melanoma through TRAF2 as a scaffold protein recruiting PIAS2 and ELAVL1 to induce EPHA5; Authors - Junfeng Du
human	WB	J Cell Mol Med; Down-regulated HDAC3 elevates microRNA-495-3p to restrain epithelial-mesenchymal transition and oncogenicity of melanoma cells via reducing TRAF5.; Authors - Yanbo Ma ; KD Validated
mouse	WB,IHC	Eur J Pharmacol; TRAF5 protects against myocardial ischemia reperfusion injury via AKT signaling.; Authors - Weipan Xu ; KO Validated
human	WB	Med Oncol; DLC-1 induces mitochondrial apoptosis and epithelial mesenchymal transition arrest in nasopharyngeal carcinoma by targeting EGFR/Akt/NF-κB pathway.; Authors - Wei Huang