• Featured Product
  • KD/KO Validated

TRAFD1 Polyclonal antibody

TRAFD1 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 27741-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

TRAF-type zinc finger domain-containing protein 1, Protein FLN29, FLN29

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, K-562 cells, A549 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman tonsillitis tissue, human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

27741-1-AP targets TRAFD1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26945

Product name: Recombinant human TRAFD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 105-335 aa of BC003553

Sequence: HEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGEEKRNEVAIPPNAYDESWGQDGIWIASQLLRQIEALDPPMRLPRRPLRAFESDVFHNRTTNQRNITAQVSIQNNLFEEQERQERNRGQQPPKEGGEESANLDFMLALSLQNEGQASSVAEQDFWRAVCEADQSHGGPRSLSDIKGAADEIMLPCEFCEELYPEELLIDHQTSCNPSRALPSLNTGSSSPRGVEEPD

Predict reactive species
Full Name TRAF-type zinc finger domain containing 1
Calculated Molecular Weight 582 aa, 65 kDa
Observed Molecular Weight 65-80 kDa
GenBank Accession NumberBC003553
Gene Symbol TRAFD1
Gene ID (NCBI) 10906
RRIDAB_2880958
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14545
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRAFD1, also known as TRAF-type zinc finger domain containing 1, is a protein that plays a significant role in immune system signaling pathways. It was first identified as an interferon- (IFN) and lipopolysaccharide- (LPS) inducible factor. TRAFD1 contains a TRAF-type zinc finger domain at its N-terminus and a TRAF6-binding motif in its middle region, which allows it to interact with other TRAF proteins and modulate immune responses. In the context of immune signaling, TRAFD1 has been shown to suppress the inflammatory responses to innate immunity by inhibiting Toll-like receptor 4 (TLR4) dependent NF-κB and MAPK activation in monocytes/macrophages. This suggests that TRAFD1 can act as a negative regulator of immune signaling, dampening the inflammatory response. Moreover, TRAFD1 has been implicated in human diseases. It is overexpressed in many B cell-related cancers, and single nucleotide polymorphisms (SNPs) in TRAFD1 have been linked to non-Hodgkin's lymphoma.

Protocols

Product Specific Protocols
WB protocol for TRAFD1 antibody 27741-1-APDownload protocol
IHC protocol for TRAFD1 antibody 27741-1-APDownload protocol
IP protocol for TRAFD1 antibody 27741-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Commun

Characterization of dsRNA binding proteins through solubility analysis identifies ZNF385A as a dsRNA homeostasis regulator

Authors - Na Jiang
Loading...
||
New chat Able
正在加载,请稍候...