TRAIP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRAIP Polyclonal antibody (10332-1-AP)

• Featured Product
• KD/KO Validated

TRAIP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10332-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TRIP, EC:2.3.2.27, RING finger protein 206, RNF206, TRAF interacting protein

• 

  WB analysis using 10332-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10332-1-AP (TRAIP antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse placenta using 10332-1-AP

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 10332-1-AP (TRAIP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 10332-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10332-1-AP (TRAIP antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 10332-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 10332-1-AP (TRAIP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 10332-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10332-1-AP (TRAIP Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10332-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10332-1-AP (TRAIP Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10332-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10332-1-AP (TRAIP Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10332-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10332-1-AP (TRAIP Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 10332-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10332-1-AP (TRAIP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 10332-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10332-1-AP (TRAIP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10332-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TRAIP antibody (10332-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRAIP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U2OS cells, A549 cells, HepG2 cells, human brain tissue, human placenta tissue, mouse placenta tissue, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human testis tissue, mouse brain tissue, mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10332-1-AP targets TRAIP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0491

  Product name: Recombinant human TRAIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-204 aa of BC000310

  Sequence: MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSL

• Full Name: TRAF interacting protein
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC000310
• Gene Symbol: TRAIP
• Gene ID (NCBI): 10293
• RRID: AB_10638481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

E3 ubiquitin-protein ligase TRAIP (TRAIP) is also named RING finger protein 206 (RNF206) and TRAF-interacting protein (TRIP). TRAIP, an E3 ligase containing a RING domain, has emerged as a significant contributor to maintaining genome integrity and TRAIP inhibits proliferation and migration of BLCA cells (PMID: 38123820). TRAIP helps replisomes overcome DNA interstrand crosslinks and DNA-protein crosslinks, whereas in mitosis it triggers disassembly of all replisomes that remain on chromatin (PMID: 33317933, PMID: 30842657).

Publications

What published studies show

The anti-TRAIP antibody (Cat# 10332-1-AP) has 11 citations published in journals including Cell Death & Disease, International Journal of Biological Sciences, Journal of Biological Chemistry, BMC Cancer, Scientific Reports, Journal of Virology, Cancer Gene Therapy, International Immunopharmacology, Biomedical Pharmacotherapy, Journal of Biochemical and Molecular Toxicology, and International Urology and Nephrology. Research fields span multiple cancers (osteosarcoma, breast, lung, thyroid, liver, prostate, tongue), stem cell biology, pulmonary fibrosis, and virology.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP,IHC	Cell Death Dis; TRAIP modulates the IGFBP3/AKT pathway to enhance the invasion and proliferation of osteosarcoma by promoting KANK1 degradation.; Authors - Mi Li ; KD Validated
human	WB	Int J Biol Sci; ESRG is critical to maintain the cell survival and self-renewal/pluripotency of hPSCs by collaborating with MCM2 to suppress p53 pathway; Authors - Shasha Li
human	WB,IHC	Cancer Gene Ther; Silencing TRAIP suppresses cell proliferation and migration/invasion of triple negative breast cancer via RB-E2F signaling and EMT; Authors - Yan Zheng ; KD Validated
human	WB,IHC	Int Immunopharmacol; TRAIP serves as a potential prognostic biomarker and correlates with immune infiltrates in lung adenocarcinoma; Authors - Yu Jing ; KD Validated
mouse	WB	Sci Rep; Phycocyanin attenuates pulmonary fibrosis via the TLR2-MyD88-NF-κB signaling pathway.; Authors - Chengcheng Li
human	WB	J Biol Chem; TRAIP promotes the development of papillary thyroid cancer by inhibiting TRAF2-mediated BRAF ubiquitination.; Authors - Huaxiao Tang ; KD Validated