TRAK1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRAK1 Polyclonal antibody, PBS Only (13987-1-PBS)

• 

  WB analysis using 13987-1-AP (same clone as 13987-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13987-1-AP (TRAK1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13987-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 13987-1-AP (same clone as 13987-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 13987-1-AP (TRAK1 antibody) at dilution of 1:200 (under 10x lens).. This data was developed using the same antibody clone with 13987-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 13987-1-AP (same clone as 13987-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 13987-1-AP (TRAK1 antibody) at dilution of 1:200 (under 40x lens).. This data was developed using the same antibody clone with 13987-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13987-1-AP (same clone as 13987-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13987-1-AP (TRAK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13987-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13987-1-AP (same clone as 13987-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13987-1-AP (TRAK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13987-1-PBS in a different storage buffer formulation.

TRAK1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13987-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

106 kDa O-GlcNAc transferase-interacting protein, KIAA1042, OIP106, Protein Milton, Trafficking kinesin-binding protein 1

---

Product Information

13987-1-PBS targets TRAK1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5055

  Product name: Recombinant human TRAK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-133 aa of BC015922

  Sequence: MSLRDKGGEEECFEYDCQDEERKPTHRQHDTQDLLEEVLCAERVGQMTKTYNDIDAVTRLLEEKERDLELAARIGQSLLKKNKTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTSAAEESEPESVC

• Full Name: trafficking protein, kinesin binding 1
• Calculated Molecular Weight: 953 aa, 106 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC015922
• Gene Symbol: TRAK1
• Gene ID (NCBI): 22906
• RRID: AB_2877999
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPV9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.