Product Information
27583-1-PBS targets TRANK1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26206 Product name: Recombinant human TRANK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 901-1000 aa of NM_014831 Sequence: MVLDHCKLADSIKAICNAYNRGLSCVLRKKLKGINKGQVSANMKIQKRIPRCYVEDTEAEKGREHVNPEYFPPASAVETEYNIMKFHSFSTNMAFNILNDT Predict reactive species |
| Full Name | lupus brain antigen 1 |
| Calculated Molecular Weight | 336 kDa |
| Observed Molecular Weight | ~330 kDa |
| GenBank Accession Number | NM_014831 |
| Gene Symbol | LBA1 |
| Gene ID (NCBI) | 9881 |
| RRID | AB_3669612 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15050 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Etratricopeptide repeat and ankyrin repeat containing 1 (TRANK1), has been confirmed as the susceptibility gene for BD (bipolar disorder). An integrated analysis of mRNA co-expression networks revealed that genes highly correlated with TRANK1 were significantly involved in the biological processes related to synaptic plasticity, dendritic spine, axon guidance and circadian rhythm. In addition, TRANK1 rs71947856 variant was associated with circadian regulation and Kleine-Levin syndrome, which is a rare disease characterized by severe episodic hypersomnia, with cognitive impairment and apathy or disinhibition.(PMID: 34014031)

