TRAPPC10 Polyclonal antibody

• 

TRAPPC10 Polyclonal Antibody for IP, ELISA

Cat No. 18256-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IP, ELISA

Synonyms

EHOC 1, EHOC1, GT334, Protein GT334, TMEM1, TRAPP subunit TMEM1, TRAPPC10, TRS130, TRS30

---

Product Information

18256-1-AP targets TRAPPC10 in IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13077

  Product name: Recombinant human TRAPPC10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 911-1259 aa of BC101728

  Sequence: QRTGRCMVTTDHKVSIDCPWSIYSTVIALTFSVPFRTTHSLLSSGTRKYVQVCVQNLSELDFQLSDSYLVDTGDSTDLQLVPLNTQSQQPIYSKQSVFFVWELKWTEEPPPSLHCRFSVGFSPASEEQLSISLKPYTYEFKVENFFTLYNVKAEIFPPSGMEYCRTGSLCSLEVLITRLSDLLEVDKDEALTESDEHFSTKLMYEVVDNSSNWAVCGKSCGVISMPVAARATHRVHMEVMPLFAGYLPLPDVRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVSVT

• Full Name: trafficking protein particle complex 10
• Calculated Molecular Weight: 1259 aa, 142 kDa
• GenBank Accession Number: BC101728
• Gene Symbol: TRAPPC10
• Gene ID (NCBI): 7109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48553
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.