TRAPPC4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRAPPC4 Polyclonal antibody (12074-1-AP)

• Featured Product
• KD/KO Validated

TRAPPC4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12074-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CGI 104, CGI-104, HSPC172, PTD009, SBDN

• 

  WB analysis using 12074-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12074-1-AP (TRAPPC4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 12074-1-AP

  WB result of TRAPPC4 antibody (12074-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRAPPC4 transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 12074-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12074-1-AP (TRAPPC4 antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HL-60 using 12074-1-AP

  IP result of anti-TRAPPC4 (IP:12074-1-AP, 4ug; Detection:12074-1-AP 1:800) with HL-60 cells lysate 1720 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12074-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12074-1-AP (TRAPPC4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12074-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12074-1-AP (TRAPPC4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 12074-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 12074-1-AP (TRAPPC4 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 12074-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TRAPPC4 antibody (12074-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HL-60 cells, MCF-7 cells, mouse testis tissue, rat testis tissue
• Positive IP detected in: HL-60 cells
• Positive IHC detected in: human colon cancer tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12074-1-AP targets TRAPPC4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2737

  Product name: Recombinant human TRAPPC4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-219 aa of BC010866

  Sequence: MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS

• Full Name: trafficking protein particle complex 4
• Calculated Molecular Weight: 219 aa, 24 kDa
• Observed Molecular Weight: 24-27 kDa
• GenBank Accession Number: BC010866
• Gene Symbol: TRAPPC4
• Gene ID (NCBI): 51399
• RRID: AB_2208147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y296
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transport protein particle (TRAPP, also known as trafficking protein particle), a multimeric guanine nucleotide-exchange factor, regulates multiple membrane trafficking pathways (PMID: 20966969). TRAPPC4, also known as synbindin, is a core component of the TRAPP complexes and one of the essential subunits for guanine nucleotide exchange factor activity for Rab1 GTPase (PMID: 31794024). Deficiencies in vesicular transport mediated by TRAPPC4 have been associated with severe syndromic intellectual disability (PMID: 31794024).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; TRAPPC4 Promotes GPX4 Stability to Drive Ferroptosis Resistance and Tumor Progression in Head and Neck Squamous Cell Carcinoma; Authors - Zhao Ding