TRAT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRAT1 Polyclonal antibody (13279-1-AP)

TRAT1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 13279-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

HSPC062, pp29/30, TCRIM, TRAT1

• 

  WB analysis of mouse thymus using 13279-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13279-1-AP (TRAT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 13279-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13279-1-AP (TRAT1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 13279-1-AP

  IP result of anti-TRAT1 (IP:13279-1-AP, 4ug; Detection:13279-1-AP 1:300) with Jurkat cells lysate 3000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 13279-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13279-1-AP (TRAT1 Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 13279-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13279-1-AP (TRAT1 Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRAT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, Jurkat cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13279-1-AP targets TRAT1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4023

  Product name: Recombinant human TRAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-186 aa of BC025713

  Sequence: ISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN

• Full Name: T cell receptor associated transmembrane adaptor 1
• Calculated Molecular Weight: 186 aa, 21 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC025713
• Gene Symbol: TRAT1
• Gene ID (NCBI): 50852
• RRID: AB_10643524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PIZ9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TRAT1 Polyclonal antibody (Cat# 13279-1-AP) has 1 citation to date. The cited publication appeared in Scientific Reports (IF 4.9), published in 2025. The research field is celiac disease, specifically examining cellular heterogeneity of small intestine tissue using single-cell transcriptome sequencing. The antibody was applied in IHC on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Sci Rep; Single cell transcriptome sequencing indicates the cellular heterogeneity of small intestine tissue in celiac disease; Authors - Tian Shi