TREML4 Polyclonal antibody

• 

  WB analysis of HL-60 using 18056-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 18056-1-AP (TREML4 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 18056-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 18056-1-AP (TREML4 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 18056-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 18056-1-AP (TREML4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human spleen using 18056-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 18056-1-AP (TREML4 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human spleen using 18056-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 18056-1-AP (TREML4 antibody) at dilution of 1:200 (under 40x lens).

TREML4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18056-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

TLT 4, TLT4, Trem like transcript 4 protein, TREML4

---

Tested Applications

• Positive WB detected in: HL-60 cells, mouse thymus tissue, U-937 cells
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18056-1-AP targets TREML4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12574

  Product name: Recombinant human TREML4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-180 aa of BC101780

  Sequence: AVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTLLVTSSKPWTAVQKSHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIITVLRNISLVVSPAPTTSPMWTLPWLPTSTVLITSPEGTSGHPSINGSETRKSRAPACLGSG

• Full Name: triggering receptor expressed on myeloid cells-like 4
• Calculated Molecular Weight: 200 aa, 22 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC101780
• Gene Symbol: TREML4
• Gene ID (NCBI): 285852
• RRID: AB_2878488
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXN2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.