TRHDE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRHDE Polyclonal antibody (21226-1-AP)

• 

  WB analysis using 21226-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21226-1-AP (TRHDE antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

TRHDE Polyclonal Antibody for WB, ELISA

Cat No. 21226-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

TRH degrading ectoenzyme, TRH DE, Thyroliberinase, Pyroglutamyl peptidase II, PGPEP2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21226-1-AP targets TRHDE in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15681

  Product name: Recombinant human TRHDE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 675-1024 aa of BC150181

  Sequence: KGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH

• Full Name: thyrotropin-releasing hormone degrading enzyme
• Calculated Molecular Weight: 1024 aa, 117 kDa
• Observed Molecular Weight: 122 kDa
• GenBank Accession Number: BC150181
• Gene Symbol: TRHDE
• Gene ID (NCBI): 29953
• RRID: AB_3742022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKU6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thyrotropin-releasing hormone-degrading ectoenzyme (TRHDE) belongs to the peptidase M1 family. TRHDE expression is detected at relatively late phases of brain development. TRHDE functions to inactivate thyrotropin-releasing hormone (PMID: 30518145, PMID: 32457627).