Tested Applications
| Positive WB detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23872-1-AP targets TRHR in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20612 Product name: Recombinant human TRHR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 310-398 aa of BC113360 Sequence: YLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKESDHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS Predict reactive species |
| Full Name | thyrotropin-releasing hormone receptor |
| Calculated Molecular Weight | 398 aa, 45 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC113360 |
| Gene Symbol | TRHR |
| Gene ID (NCBI) | 7201 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P34981 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRHR is a Gq-coupled neuroendocrine GPCR that mediates the actions of thyrotropin-releasing hormone in the anterior pituitary and brain. By activating PLC-Ca²⁺ signaling, TRHR controls TSH secretion, regulates thyroid hormone output, and influences metabolic rate and neuroendocrine behavior. Genetic or functional disruption of TRHR leads to central hypothyroidism and broader metabolic and neurological consequences, highlighting its essential role in HPT axis regulation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TRHR antibody 23872-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

