TRIM15 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRIM15 Polyclonal antibody (13623-1-AP)

• Featured Product
• KD/KO Validated

TRIM15 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13623-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, IP, ELISA

Synonyms

RING finger protein 93, RNF93, TRIM15, tripartite motif containing 15, Zinc finger protein 178, Zinc finger protein B7, ZNF178, ZNFB7

• 

  WB analysis of Jurkat using 13623-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13623-1-AP (TRIM15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 13623-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13623-1-AP (TRIM15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 13623-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13623-1-AP (TRIM15 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 13623-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13623-1-AP (TRIM15 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRIM15 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13623-1-AP targets TRIM15 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4533

  Product name: Recombinant human TRIM15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of BC038585

  Sequence: MPATPSLKVVHELPACTLCAGPLEDAVTIPCGHTFCRLCLPALSQMGAQSSGKILLCPLCQEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLDEAIQPYRDRLRSRLEALSTERDEIEDVKCQEDQKLQVLLTQIESKKHQVETAFERLQQELEQQRCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRVNQSRCEMKTFVSPEAISPDLVKKIRDFHRK

• Full Name: tripartite motif-containing 15
• Calculated Molecular Weight: 465 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC038585
• Gene Symbol: TRIM15
• Gene ID (NCBI): 89870
• RRID: AB_2303892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C019
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM15 (Tripartite motif-containing protein 15) is also named as RNF93, ZNF178, ZNFB7 and belongs to the TRIM/RBCC family. It acts as an ubiquitin-protein ligase and contributes to the endogenous restriction of retroviruses in cells.

Publications

What published studies show

The TRIM15 antibody (Cat# 13623-1-AP) has 10 citations published in Nature Cell Biology, Cell Death & Disease, Cell Death Discovery, Cancer Cell International, BBA – Molecular Basis of Disease, iScience, Journal of Virology, Journal of Cell Science, and Journal of Cancer. Associated research fields include ubiquitination-mediated signaling, Wnt pathway regulation, autophagy, DNA methylation, focal adhesion dynamics, and multiple cancer types such as hepatocellular, colorectal, ovarian, pancreatic, and lung cancers.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; TRIM15 and CYLD regulate ERK activation via lysine-63-linked polyubiquitination.; Authors - Guixin Zhu ; KO Validated
human	WB	Cell Death Dis; Targeting TRIM15-mediated Axin1 depolymerization suppresses Wnt signaling and inhibits colorectal cancer growth.; Authors - Hangfei Liang ; KO Validated
human	WB	Cell Death Dis; TRIM15 forms a regulatory loop with the AKT/FOXO1 axis and LASP1 to modulate the sensitivity of HCC cells to TKIs; Authors - Chong Yang
human	WB	Cell Death Discov; Trim15 stabilizes VDAC3 via ubiquitination to suppress autophagy and enhance chemosensitivity in hypopharyngeal squamous cell carcinoma.; Authors - Guangyi Wang ; KD Validated
		Cancer Cell Int; TRIM15 Mediates ubiquitination of Paxillin to facilitate the progression of ovarian cancer.; Authors - Jiaqi Xu
human	WB,IP,IF	Biochim Biophys Acta Mol Basis Dis; Ubiquitin ligase TRIM15 promotes the progression of pancreatic cancer via the upregulation of the IGF2BP2-TLR4 axis; Authors - Hongkun Cai