TRIM2 Monoclonal antibody, PBS Only

• 

  WB analysis of rat brain using 67342-1-Ig (same clone as 67342-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67342-1-Ig (TRIM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67342-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 67342-1-Ig (same clone as 67342-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 67342-1-Ig (TRIM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67342-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67342-1-Ig (same clone as 67342-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67342-1-Ig (TRIM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67342-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67342-1-Ig (same clone as 67342-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67342-1-Ig (TRIM2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67342-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67342-1-Ig (same clone as 67342-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67342-1-Ig (TRIM2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67342-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 67342-1-Ig (same clone as 67342-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 67342-1-Ig (TRIM2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67342-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 67342-1-Ig (same clone as 67342-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 67342-1-Ig (TRIM2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67342-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 67342-1-Ig (same clone as 67342-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using TRIM2 antibody (67342-1-Ig, Clone: 1H9C2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67342-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 67342-1-Ig (same clone as 67342-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using TRIM2 antibody (67342-1-Ig, Clone: 1H9C2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67342-1-PBS in a different storage buffer formulation.

TRIM2 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67342-1-PBS

Clone No.1H9C2

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

KIAA0517, RING finger protein 86, RNF86, TRIM2, tripartite motif containing 2

---

Product Information

67342-1-PBS targets TRIM2 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.

• Tested Reactivity: Human, Mouse, Rat, Pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14637

  Product name: Recombinant human TRIM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-300 aa of BC011052

  Sequence: MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD

• Full Name: tripartite motif-containing 2
• Calculated Molecular Weight: 744 aa, 82 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: BC011052
• Gene Symbol: TRIM2
• Gene ID (NCBI): 23321
• RRID: AB_2882600
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9C040
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tripartite motif-containing 2(TRIM2) is an E3 ubiquitin ligase which directs proteasome-mediated degradation of target proteins by the ubiquitination of NEFL and phosphorylation of BCL2L11. This protein contains an N-terminal RING domain, followed by a B-box-2 domain, a coiled-coil region, and 6 C-terminal NHL repeats. TRIM2 involves in the apoptotic response to ischemia via directing degradation of BIM protein, thus has a role in neuroprotection.