TRIM21 Monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP50371-3

  Sandwich ELISA standard curve of MP50371-3, Human TRIM21 Monoclonal Matched Antibody Pair - PBS only. 67136-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag28377. 67136-4-PBS was HRP conjugated as the detection antibody. Range: 3.13-200 ng/mL.

• 

  Sample test of MP50371-3

  The mean TRIM21 concentration was determined to be 3,629.08 ng/mL in HL-60 cell extract based on a 3.70 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP50371-3

  Cytometric bead array standard curve of MP50371-3, TRIM21 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67136-2-PBS. Detection antibody: 67136-4-PBS. Standard:Ag28377. Range: 0.391-100 ng/mL.

TRIM21 Monoclonal Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 67136-4-PBS

Clone No.1E7G4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

---

Product Information

67136-4-PBS targets TRIM21 as part of a matched antibody pair:

MP50371-3: 67136-2-PBS capture and 67136-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28377

  Product name: Recombinant human TRIM21 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 176-475 aa of BC010861

  Sequence: SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY

• Full Name: tripartite motif-containing 21
• Calculated Molecular Weight: 475 aa, 54 kDa
• GenBank Accession Number: BC010861
• Gene Symbol: TRIM21
• Gene ID (NCBI): 6737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P19474
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.