TRIM23 Polyclonal antibody

• 

  WB analysis of HEK-293 using 12607-1-AP

  WB result of TRIM23 antibody (12607-1-AP; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRIM23 transfected HEK-293 cells.

• 

  WB analysis of mouse brain using 12607-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12607-1-AP (TRIM23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12607-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12607-1-AP (TRIM23 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 12607-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 12607-1-AP (TRIM23 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

TRIM23 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 12607-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

ARFD1, ARD1, RNF46, GTP binding protein ARD 1, EC:2.3.2.27

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HEK-293 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

12607-1-AP targets TRIM23 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3302

  Product name: Recombinant human TRIM23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 275-574 aa of BC022510

  Sequence: EHVPGTAENARSCIRAYFYDLHETLCRQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDDCRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA

• Full Name: tripartite motif-containing 23
• Calculated Molecular Weight: 574 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC022510
• Gene Symbol: TRIM23
• Gene ID (NCBI): 373
• RRID: AB_2256643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36406
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO J; Energy stress promotes P-bodies formation via lysine-63-linked polyubiquitination of HAX1; Authors - Wanqi Zhan
	WB	Int J Biol Macromol; Engineering the orthogonal ubiquitin E1-E2 pairs for identification of K27 chain linkage substrates; Authors - Yanan Wang