TRIM24 Monoclonal antibody, PBS Only

• 

  WB analysis using 66324-1-Ig (same clone as 66324-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66324-1-Ig (TRIM24 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66324-1-Ig (same clone as 66324-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66324-1-Ig (TRIM24 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66324-1-Ig (same clone as 66324-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66324-1-Ig (TRIM24 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66324-1-Ig (same clone as 66324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66324-1-Ig (TRIM24 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66324-1-Ig (same clone as 66324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66324-1-Ig (TRIM24 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66324-1-Ig (same clone as 66324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66324-1-Ig (TRIM24 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66324-1-Ig (same clone as 66324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66324-1-Ig (TRIM24 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66324-1-Ig (same clone as 66324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66324-1-Ig (TRIM24 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66324-1-Ig (same clone as 66324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66324-1-Ig (TRIM24 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66324-1-Ig (same clone as 66324-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TRIM24 antibody (66324-1-Ig, Clone: 1D6D9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66324-1-PBS in a different storage buffer formulation.

TRIM24 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66324-1-PBS

Clone No.1D6D9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1D6D9, E3 ubiquitin-protein ligase TRIM24, EC:2.3.2.27, RING-type E3 ubiquitin transferase TIF1-alpha, TIF1

---

Product Information

66324-1-PBS targets TRIM24 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5417

  Product name: Recombinant human TRIM24 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 701-1050 aa of BC028689

  Sequence: SKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK

• Full Name: tripartite motif-containing 24
• Calculated Molecular Weight: 117 kDa
• Observed Molecular Weight: 116 kDa
• GenBank Accession Number: BC028689
• Gene Symbol: TRIM24
• Gene ID (NCBI): 8805
• RRID: AB_2881705
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O15164
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRIM24, also named as RNF82, TIF1 and TIF1A, interacts selectively in vitro with the AF2-activating domain of the estrogen receptors. Association with DNA-bound estrogen receptors, it requires the presence of estradiol. It is a regulation protein of P53. Defects in TRIM24 are a cause of thyroid papillary carcinoma (TPC) which is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue.