TRIM27 Polyclonal antibody

• 

  WB analysis using 28751-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28751-1-AP (TRIM27 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 28751-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28751-1-AP (TRIM27 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon cancer using 28751-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28751-1-AP (TRIM27 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of mouse testis using 28751-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28751-1-AP (TRIM27 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH9).

• 

  IHC staining of mouse testis using 28751-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28751-1-AP (TRIM27 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH9).

• Featured Product
• KD/KO Validated

TRIM27 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28751-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

Ret finger protein, RFP, RING finger protein 76, RNF76, TRIM27, tripartite motif containing 27, Zinc finger protein RFP

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, Raji cells
• Positive IHC detected in: human colon cancer tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IF: See 1 publications below

Product Information

28751-1-AP targets TRIM27 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30576

  Product name: Recombinant human TRIM27 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 233-352 aa of BC013580

  Sequence: IAQLEEKQQQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPE

• Full Name: tripartite motif-containing 27
• Calculated Molecular Weight: 513 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC013580
• Gene Symbol: TRIM27
• Gene ID (NCBI): 5987
• RRID: AB_2881207
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14373
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB, IF	Lab Invest; TRIM27 contributes to glomerular endothelial cell injury in lupus nephritis by mediating the FoxO1 signaling pathway.; Authors - Jinxi Liu ; KD Validated