Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, Raji cells |
| Positive IHC detected in | human colon cancer tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28751-1-AP targets TRIM27 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse samples.
| Tested Reactivity | Human, Mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30576 Product name: Recombinant human TRIM27 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 233-352 aa of BC013580 Sequence: IAQLEEKQQQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPE Predict reactive species |
| Full Name | tripartite motif-containing 27 |
| Calculated Molecular Weight | 513 aa, 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC013580 |
| Gene Symbol | TRIM27 |
| Gene ID (NCBI) | 5987 |
| RRID | AB_2881207 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14373 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TRIM27 antibody 28751-1-AP | Download protocol |
| WB protocol for TRIM27 antibody 28751-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









