TRIM29 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HT-29 using 86496-1-RR (same clone as 86496-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 86496-1-RR (TRIM29 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86496-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86496-1-RR (same clone as 86496-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86496-1-RR (TRIM29 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86496-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86496-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86496-1-RR against Human TRIM29 were performed. The affinity constant is 0.424 nM.

TRIM29 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86496-1-PBS

Clone No.251298E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Ataxia telangiectasia group D-associated protein, ATDC, tripartite motif containing 29, Tripartite motif-containing protein 29

---

Product Information

86496-1-PBS targets TRIM29 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11600

  Product name: Recombinant human TRIM29 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 239-588 aa of BC017352

  Sequence: DQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP

• Full Name: tripartite motif-containing 29
• Calculated Molecular Weight: 588 aa, 66 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC017352
• Gene Symbol: TRIM29
• Gene ID (NCBI): 23650
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14134
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRIM29(Tripartite motif-containing protein 29) is also named as ATDC( Ataxia telangiectasia group D-associated protein). ATDC protein physically interacted with the intermediate filament protein vimentin, a protein kinase C substrate and colocalizing protein, and with an inhibitor of protein kinase C, PKCI1 (PMID:7644499). Knockdown of TRIM29 in airway epithelial cells enhances type I interferon production, and in human nasopharyngeal carcinoma cells results in almost complete Epstein-Barr virus clearance. TRIM29 is also highly induced by cytosolic double-stranded DNA in myeloid dendritic cells (PMID: 29038422). Western detected both full-length TRIM29 (65 kDa) and a truncated variant of TRIM29 with a molecular weight of about 50 kDa (PMID: 26095369).