TRIM39 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRIM39 Polyclonal antibody, PBS Only (12757-1-PBS)

• 

  WB analysis using 12757-1-AP (same clone as 12757-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12757-1-AP (TRIM39 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12757-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 12757-1-AP (same clone as 12757-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12757-1-AP (TRIM39 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12757-1-PBS in a different storage buffer formulation.

TRIM39 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12757-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12757-1-PBS targets TRIM39 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3486

  Product name: Recombinant human TRIM39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 189-489 aa of BC034985

  Sequence: RRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKRRDLAHLAAEVEGKCLQSGFEMLKDVKSTLEKCEKVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLTIRPPTDWE

• Full Name: tripartite motif-containing 39
• Calculated Molecular Weight: 488aa,56 kDa; 518aa,60 kDa
• Observed Molecular Weight: 45 kDa, 56-60 kDa
• GenBank Accession Number: BC034985
• Gene Symbol: TRIM39
• Gene ID (NCBI): 56658
• RRID: AB_10646480
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCM9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.