TRIM40 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRIM40 Polyclonal antibody, PBS Only (24526-1-PBS)

• 

  WB analysis using 24526-1-AP (same clone as 24526-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24526-1-AP (TRIM40 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24526-1-PBS in a different storage buffer formulation.

TRIM40 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24526-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24526-1-PBS targets TRIM40 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21649

  Product name: Recombinant human TRIM40 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-258 aa of BC060785

  Sequence: MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL

• Full Name: tripartite motif-containing 40
• Calculated Molecular Weight: 258 aa, 29 kDa
• Observed Molecular Weight: 29-35 kDa
• GenBank Accession Number: BC060785
• Gene Symbol: TRIM40
• Gene ID (NCBI): 135644
• RRID: AB_3669440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P9F5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.