TRIM44 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRIM44 Polyclonal antibody (11511-1-AP)

• Featured Product
• KD/KO Validated

TRIM44 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11511-1-AP Copied!

Publications (25)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

DIPB, HSA249128, MC7, Protein DIPB, TRIM

• 

  WB analysis of mouse testis using 11511-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11511-1-AP (TRIM44 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 11511-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11511-1-AP (TRIM44 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11511-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11511-1-AP (TRIM44 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11511-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11511-1-AP (TRIM44 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRIM44 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human liver tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11511-1-AP targets TRIM44 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2070

  Product name: Recombinant human TRIM44 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC024031

  Sequence: MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEG

• Full Name: tripartite motif-containing 44
• Calculated Molecular Weight: 344 aa, 38 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC024031
• Gene Symbol: TRIM44
• Gene ID (NCBI): 54765
• RRID: AB_2303802
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96DX7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM44 is one of the family member of TRIM protein, which contains an N-terminal ubiquitin hydrolase-type zinc-finger domain, followed by a coiled-coil domain, a zinc-finger B-box homology domain, and a second coiled-coil domain near the C-terminus. Members of the TRIM protein family are involved in various cellular processes, such as cell proliferation, oncogenesis and antiviral defense. This is a rabbit polyantibody raised against full length of human TRIM44.

Publications

What published studies show

The TRIM44 antibody (Cat# 11511-1-AP) has 25 citations. Journals include Gastroenterology, Nature Communications, Autophagy, Oncogene, Journal of Translational Medicine, Cancer Science, Cell Signaling, Journal of Immunology, and others. Research fields span oncology (gastric, esophageal, lung, liver, colorectal, glioma, and hematologic cancers), autophagy, cardiac remodeling/fibrosis, viral replication, DNA damage repair, pyroptosis, and diabetic retinopathy. Applications include WB, IHC, IF, and IP.

Automatically generated from the 25 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Gastroenterology; A 4-gene signature predicts survival of patients with resected adenocarcinoma of the esophagus, junction, and gastric cardia.; Authors - Peters Christopher J CJ
human	WB,IF	Autophagy; TRIM44 links the UPS to SQSTM1/p62-dependent aggrephagy and removing misfolded proteins.; Authors - Lin Lyu ; KO Validated
		Nat Commun; AMC-F1 regulates mitochondria-autophagy crosstalk independent of nutrient stress.; Authors - Yuqin Wang
rat	WB,IF	J Transl Med; Aberrant expression of TRIM44, transcriptionally regulated by KLF9, contributes to the process of diabetic retinopathy; Authors - Ning Han
human	WB,IP,IF	Oncogene; TRIM44 mediated p62 deubiquitination enhances DNA damage repair by increasing nuclear FLNA and 53BP1 expression.; Authors - Lin Lyu ; KO Validated
human	WB	Cells; TRIM44, a Novel Prognostic Marker, Supports the Survival of Proteasome-Resistant Multiple Myeloma Cells; Authors - Trung Vu