TRIM44 Monoclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 66249-1-Ig (same clone as 66249-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66249-1-Ig (TRIM44 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66249-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 66249-1-Ig (same clone as 66249-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 66249-1-Ig (TRIM44 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66249-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 66249-1-Ig (same clone as 66249-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed MCF-7 cells using 66249-1-Ig(TRIM44 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66249-1-PBS in a different storage buffer formulation.

TRIM44 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66249-1-PBS

Clone No.1B12H12

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

DIPB, HSA249128, MC7, Protein DIPB, TRIM44, tripartite motif containing 44

---

Product Information

66249-1-PBS targets TRIM44 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18771

  Product name: Recombinant human TRIM44 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-334 aa of BC024031

  Sequence: MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEG

• Full Name: tripartite motif-containing 44
• Calculated Molecular Weight: 344 aa, 38 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC024031
• Gene Symbol: TRIM44
• Gene ID (NCBI): 54765
• RRID: AB_2881637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96DX7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRIM44 is one of the family member of TRIM protein, which contains an N-terminal ubiquitin hydrolase-type zinc-finger domain, followed by a coiled-coil domain, a zinc-finger B-box homology domain, and a second coiled-coil domain near the C-terminus. Members of the TRIM protein family are involved in various cellular processes, such as cell proliferation, oncogenesis and antiviral defense.