TRIM52 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRIM52 Polyclonal antibody (20948-1-AP)

• 

  WB analysis using 20948-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20948-1-AP (TRIM52 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 20948-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 20948-1-AP (TRIM52 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TRIM52 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20948-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

RNF102, tripartite motif containing 52

---

Tested Applications

• Positive WB detected in: NCI-H1299 cells, OVCAR-3 cells, SKOV-3 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20948-1-AP targets TRIM52 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15064

  Product name: Recombinant human TRIM52 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-297 aa of BC007372

  Sequence: MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWSKEDEEDQNEEEDEWEEEEDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEEEEEEEDQDYYLGGLRPDLRIDVYREEEILEAYDEDEDEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLANMVQIIRQMCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ

• Full Name: tripartite motif-containing 52
• Calculated Molecular Weight: 297 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC007372
• Gene Symbol: TRIM52
• Gene ID (NCBI): 84851
• RRID: AB_3742009
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96A61
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM52 (Tripartite motif 52) is a member of the family of highly conserved RBCC (a RING-finger, two B-boxes, and a predicted alpha-helical Coiled-Coil domain were linked to the N-terminal region in sequence) proteins with more than 70 isoforms, which plays an important role in tumorigenesis through different signaling pathways (PMID: 35837156). TRIM52 promotes tumorigenesis in ovarian cancer by activating the nuclear factor (NF)-κB signaling pathway. Knocking-down of TRIM52 in ovarian cancer cells suppresses cell invasion, cell migration and cell proliferation, while inducing apoptosis (PMID: 30918473, 28073078).