TRIM56 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TRIM56 Recombinant monoclonal antibody, PBS Only (84896-7-PBS)

• 

  IF Staining of MCF-7 using 84896-7-RR (same clone as 84896-7-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using TRIM56 antibody (84896-7-RR, Clone: 242497D3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84896-7-PBS in a different storage buffer formulation.

TRIM56 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84896-7-PBS

Clone No.242497D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

242497D3, E3 ubiquitin-protein ligase TRIM56, EC:2.3.2.27, RING finger protein 109, RNF109

---

Product Information

84896-7-PBS targets TRIM56 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21992

  Product name: Recombinant human TRIM56 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-258 aa of BC048194

  Sequence: MVSHGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLADGGRVRCPECRETVPVPPEGVASFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARCLDCADDLCQACADGHRCTRQTHTHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFLCQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEGLLAGVDNNLVELEAARRVEKEALARLREQAARVGTQVEEA

• Full Name: tripartite motif-containing 56
• Calculated Molecular Weight: 755 aa, 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC048194
• Gene Symbol: TRIM56
• Gene ID (NCBI): 81844
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9BRZ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.