TRIM59 Polyclonal antibody

• 

  WB analysis using 28575-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28575-1-AP (TRIM59 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28575-1-AP

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 28575-1-AP (TRIM59 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 28575-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 28575-1-AP (TRIM59 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 28575-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28575-1-AP (TRIM59 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 28575-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 28575-1-AP (TRIM59 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 28575-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28575-1-AP (TRIM59 antibody) at dilution of 1:1000 (under 40x lens).

• 

  IF Staining of U2OS using 28575-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using TRIM59 antibody (28575-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

TRIM59 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28575-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ChIP, ELISA

Synonyms

MRF1, RING finger protein 104, RNF104, TRIM57, TRIM59, tripartite motif containing 59, TSBF1, Tumor suppressor TSBF 1

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, rat spleen tissue
• Positive IHC detected in: human pancreas cancer tissue, human liver tissue, human breast cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• CoIP: See 2 publications below
• ChIP: See 1 publications below

Product Information

28575-1-AP targets TRIM59 in WB, IHC, IF/ICC, CoIP, ChIP, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29560

  Product name: Recombinant human TRIM59 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 128-326 aa of NM_173084

  Sequence: GHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEF

• Full Name: tripartite motif-containing 59
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: NM_173084
• Gene Symbol: TRIM59
• Gene ID (NCBI): 286827
• RRID: AB_2918177
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWR1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM59 belongs to the tripartite motif (TRIM) family. It functions as E3 ubiquitin ligases or an adaptor protein, and plays important roles in various types of human cancers.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	CoIP,ChIP	J Transl Med; A role of TRIM59 in pulmonary hypertension: modulating the protein ubiquitylation modification; Authors - Yingli Liu
human	WB,CoIP	Heliyon; TRIM59-mediated ferroptosis enhances neuroblastoma development and chemosensitivity through p53 ubiquitination and degradation; Authors - Yingbei Liu ; KD Validated