TRIM6 Polyclonal antibody

• 

  WB analysis using 11953-1-AP

  HepG2 cell lysates were subjected to SDS PAGE followed by western blot with 11953-1-AP (TRIM6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 11953-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 11953-1-AP (TRIM6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 11953-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11953-1-AP (TRIM6 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 11953-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11953-1-AP (TRIM6 antibody) at dilution of 1:50 (under 10x lens).

• Featured Product
• KD/KO Validated

TRIM6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11953-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

RING finger protein 89, RNF89, TRIM6, tripartite motif containing 6

---

Tested Applications

• Positive WB detected in: HepG2 cells, COLO 320 cells, human liver tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 6 publications below
• IHC: See 4 publications below
• IF: See 1 publications below
• IP: See 2 publications below
• CoIP: See 2 publications below

Product Information

11953-1-AP targets TRIM6 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2556

  Product name: Recombinant human TRIM6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-395 aa of BC065575

  Sequence: QLRNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELISDLERRCQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVDVAKKTAWILGVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSPSLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIPMTLRRPSS

• Full Name: tripartite motif-containing 6
• Calculated Molecular Weight: 488 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC065575
• Gene Symbol: TRIM6
• Gene ID (NCBI): 117854
• RRID: AB_874230
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C030
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Oxid Med Cell Longev; TRIM6 Reduces Ferroptosis and Chemosensitivity by Targeting SLC1A5 in Lung Cancer; Authors - Ying Zhang
human	IHC	Front Oncol; Tripartite Motif Protein 6 Promotes Colorectal Cancer Cell Migration and Metastasis via SOCS2-STAT3 Signaling; Authors - Hongjian Zhao
human	WB	Brain Res Bull; LINC02282 promotes DNA methylation of TRIM6 by recruiting DNMTs to inhibit the progression of Parkinson's disease; Authors - Lu Han
human	WB,IHC,CoIP	J Exp Clin Cancer Res; TRIM6 promotes colorectal cancer cells proliferation and response to thiostrepton by TIS21/FoxM1.; Authors - Shuier Zheng ; KD Validated
human	WB,IHC	J Chem Neuroanat; Silencing TRIM6 inhibits the growth and angiogenesis of gliomas by regulating VEGFA; Authors - Xin Liu
human	WB,IF,IP	J Med Virol; TRIM6 facilitates SARS-CoV-2 proliferation by catalyzing the K29-typed ubiquitination of NP to enhance the ability to bind viral genomes; Authors - Jian Zhou ; KD Validated