TRIM7 Polyclonal antibody

• 

  WB analysis using 26285-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26285-1-AP (TRIM7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 26285-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 26285-1-AP (TRIM7 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 26285-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 26285-1-AP (TRIM7 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TRIM7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26285-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

RING finger protein 90, GNIP, Glycogenin-interacting protein, Glycogenin interacting protein, EC:2.3.2.27

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

26285-1-AP targets TRIM7 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23453

  Product name: Recombinant human TRIM7 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 435-511 aa of BC132863

  Sequence: LQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNFQERVFPLFSVCSTGTYLRIWP

• Full Name: tripartite motif-containing 7
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC132863
• Gene Symbol: TRIM7
• Gene ID (NCBI): 81786
• RRID: AB_2880462
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C029
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EBioMedicine; N6-Methyladenosine modification of the TRIM7 positively regulates tumorigenesis and chemoresistance in osteosarcoma through ubiquitination of BRMS1.; Authors - Chenliang Zhou
human	WB	J Virol; Nascent Transcriptomics Reveal Cellular Prolytic Factors Upregulated Upstream of the Latent-to-Lytic Switch Protein of Epstein-Barr Virus.; Authors - Tiffany R Frey ; KD Validated
human	WB	Vet Microbiol; TRIM7 inhibits encephalomyocarditis virus replication by activating interferon-β signaling pathway; Authors - Minjing Li
human,mouse	WB,IHC,IF,CoIP	Sci Rep; The E3 ligase TRIM7 suppresses the tumorigenesis of gastric cancer by targeting SLC7A11; Authors - Qishuai Chen ; KD Validated
		mBio; The E3 ligase TRIM22 restricts SARS-CoV-2 replication by promoting proteasomal degradation of NSP8; Authors - Lujie Fan
mouse	WB	Am J Pathol; E3 Ubiquitin Ligase TRIM7 Alleviates LPS-Induced Acute Lung Injury via Inhibiting NLRP3 Inflammasome Activation; Authors - Youna Wang