TRIM7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRIM7 Polyclonal antibody (26285-1-AP)

• Featured Product
• KD/KO Validated

TRIM7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26285-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (2)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

RING finger protein 90, GNIP, Glycogenin-interacting protein, Glycogenin interacting protein, EC:2.3.2.27

• 

  WB analysis using 26285-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26285-1-AP (TRIM7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 26285-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 26285-1-AP (TRIM7 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 26285-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 26285-1-AP (TRIM7 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRIM7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26285-1-AP targets TRIM7 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23453

  Product name: Recombinant human TRIM7 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 435-511 aa of BC132863

  Sequence: LQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNFQERVFPLFSVCSTGTYLRIWP

• Full Name: tripartite motif-containing 7
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC132863
• Gene Symbol: TRIM7
• Gene ID (NCBI): 81786
• RRID: AB_2880462
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C029
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-TRIM7 antibody (Cat# 26285-1-AP) has 13 citations published in journals including Phytomedicine, EBioMedicine, mBio, Am J Pathol, Sci Rep, J Virol, Cell Biosci, Int Immunopharmacol, Emerg Microbes Infect, Vet Res, Vet Microbiol, Toxicol Res, and J Gastrointest Oncol. Research fields span viral replication (rabies, SARS-CoV-2, EBV), cancer (osteosarcoma, gastric cancer, colon adenocarcinoma), ferroptosis, ischemic stroke, renal injury, acute lung injury, and inflammation.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Phytomedicine; Columbianadin targets TRIM7 to maintain P2X7 palmitoylation, inhibiting cuproptosis in synovial M2 macrophages; Authors - Zihao Li
human	WB	EBioMedicine; N6-Methyladenosine modification of the TRIM7 positively regulates tumorigenesis and chemoresistance in osteosarcoma through ubiquitination of BRMS1.; Authors - Chenliang Zhou
mouse	WB,CoIP	Emerg Microbes Infect; TRIM7 Inhibits Rabies Virus Replication by Promoting K48-Linked Ubiquitination and Degradation of RABV-M.; Authors - Hongling He ; KD Validated
mouse	WB	Cell Biosci; Trim7 aggravates ischemic stroke-associated ferroptosis by promoting ubiquitin-mediated degradation of HSPA5.; Authors - Wenxuan Lu ; KO Validated
mouse, human	WB	Int Immunopharmacol; TRIM7 negatively regulates CMPK2 suppressing inflammation and apoptosis in renal ischemia-reperfusion injury.; Authors - Long Zhang ; KO Validated
		mBio; The E3 ligase TRIM22 restricts SARS-CoV-2 replication by promoting proteasomal degradation of NSP8; Authors - Lujie Fan