• Featured Product
  • KD/KO Validated

TRIM9 Polyclonal antibody

TRIM9 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 10786-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

KIAA0282, RING finger protein 91, RNF91, SPRING, TRIM9, tripartite motif containing 9

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HepG2 cells, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inrat brain tissue, human prostate cancer tissue, rat cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10786-1-AP targets TRIM9 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1238

Product name: Recombinant human TRIM9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC013414

Sequence: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVR

Predict reactive species
Full Name tripartite motif-containing 9
Calculated Molecular Weight 80 kDa
Observed Molecular Weight 79 kDa, 90 kDa, 61 kDa
GenBank Accession NumberBC013414
Gene Symbol TRIM9
Gene ID (NCBI) 114088
RRIDAB_2209130
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9C026
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM9(E3 ubiquitin-protein ligase TRIM9) is also named as RNF91 and belongs to the TRIM/RBCC family. TRIM9 protein is a brain-specific E3 ubiquitin ligase. Importantly, TRIM9 is present in LBs found in DLB and PD, suggesting that TRIM9 not only plays roles in the regulation of neuronal functions, but also participates in the formation or breakdown of abnormal inclusions through its ligase activity and besides the striatum and hippocampus, the highest expression of TRIM9 protein is seen in the frontal, temporal and occipital cortices through the western blot (PMID:20085810). It has been reported that TRIM9 is highly expressed in the cerebral cortex in mouse and human brains and that TRIM9 is decreased in damaged brains in patients who have Parkinson disease and dementia with Lewy bodies(PMID:22337885). It has 3 isoforms with molecular mass of 79, 90 and 61 kDa.

Protocols

Product Specific Protocols
WB protocol for TRIM9 antibody 10786-1-APDownload protocol
IHC protocol for TRIM9 antibody 10786-1-APDownload protocol
IP protocol for TRIM9 antibody 10786-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Res

PMID: 26915459

Authors - Yunfei Qin
  • KD Validated
human, mouse, ratWB

Neurobiol Dis

TRIM9, a novel brain-specific E3 ubiquitin ligase, is repressed in the brain of Parkinson's disease and dementia with Lewy bodies.

Authors - Tanji Kunikazu K
ratWB,IP

Mol Med Rep

Knockdown of TRIM9 attenuates irinotecan‑induced intestinal mucositis in IEC‑6 cells by regulating DUSP6 expression via the P38 pathway.

Authors - Wenjun Zhao
  • KD Validated
humanIHC

Springerplus

Promoter methylation of TRIM9 as a marker for detection of circulating tumor DNA in breast cancer patients.

Authors - Chieko Mishima
mouseWB

Elife

A twin UGUA motif directs the balance between gene isoforms through CFIm and the mTORC1 signaling pathway

Authors - R Samuel Herron
mouseWB

Mol Biol Cell

The E3 ubiquitin ligase TRIM9 regulates synaptic function and actin dynamics in response to netrin-1

Authors - Laura E McCormick
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Echo (Verified Customer) (03-20-2024)

The quality was good. Saw two bands for western blot.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
TRIM9 Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:10786-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...