TRIP4 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TRIP4 Recombinant monoclonal antibody (88025-1-RR)

• 

  WB analysis using 88025-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88025-1-RR (TRIP4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 88025-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TRIP4 antibody (88025-1-RR, Clone: 260262F12 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity of 88025-1-RR

  Biolayer interferometry (BLI) kinetic assays of 88025-1-RR against Human TRIP4 were performed. The affinity constant is 0.266 nM.

TRIP4 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 88025-1-RR

Clone No.260262F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

ASC 1, ASC-1, HsT17391, RQT4, Thyroid receptor-interacting protein 4

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, COLO 320 cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88025-1-RR targets TRIP4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2987

  Product name: Recombinant human TRIP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-581 aa of BC012448

  Sequence: QVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV

• Full Name: thyroid hormone receptor interactor 4
• Calculated Molecular Weight: 581 aa, 66 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC012448
• Gene Symbol: TRIP4
• Gene ID (NCBI): 9325
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15650
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thyroid hormone receptor interactor 4(TRIP4), other named ASC1, is a transcriptional coactivator that promote transcriptional efficiencies. It harbors an autonomous transactivation domain that contains a putative zinc finger motif, which serves as a binding site for nuclear receptors for thyroid, estrogen, all-trans-retinoic acid and RXR by interaction with SRC-1 or CBP/p300. There are two forms of ASC1 have been detected in mRNA level, isoform1(581aa, ~65kd) and isoform2(539aa,~60kd)(12077347,12390891)