TRMT1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85897-5-RR (same clone as 85897-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85897-5-RR (TRMT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85897-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85897-5-RR (same clone as 85897-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TRMT1 antibody (85897-5-RR, Clone: 250178D5 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85897-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85897-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85897-5-RR against Human TRMT1 were performed. The affinity constant is 26.2 pM.

TRMT1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85897-5-PBS

Clone No.250178D5

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:2.1.1.216, TRM1, TRMT 1, tRNA (guanine(26)-N(2))-dimethyltransferase, tRNA 2,2-dimethylguanosine-26 methyltransferase

---

Product Information

85897-5-PBS targets TRMT1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6837

  Product name: Recombinant human TRMT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 371-659 aa of BC002492

  Sequence: KFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGPGAAAGPGID

• Full Name: TRM1 tRNA methyltransferase 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC002492
• Gene Symbol: TRMT1
• Gene ID (NCBI): 55621
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NXH9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRMT1 is an RNA methyltransferase responsible for the formation of N2,N2-dimethylguanosine (m2,2G) at position 26 in both cytosolic and mitochondrial tRNAs.TRMT1-catalyzed tRNA modifications are important for maintenance of global protein translation levels including proteins involved in cellular growth, development, and stress response. Human neural stem cells with TRMT1 knockdowns were found to have hypersensitivity to redox stress, implicating TRMT1 and the m2,2G26 modification in the regulation of redox homeostasis.