TRMT10C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRMT10C Polyclonal antibody (29087-1-AP)

• 

  WB analysis using 29087-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29087-1-AP (TRMT10C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 29087-1-AP

  WB result of TRMT10C antibody (29087-1-AP; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRMT10C transfected HepG2 cells.

• 

  IHC staining of human colon cancer using 29087-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29087-1-AP (TRMT10C antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 29087-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29087-1-AP (TRMT10C antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 29087-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using TRMT10C antibody (29087-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

TRMT10C Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29087-1-AP

Publications(8)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

RG9MTD1, MRPP1

---

Tested Applications

• Positive WB detected in: HepG2 cells, PC-12 cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 8 publications below
• IF: See 1 publications below

Product Information

29087-1-AP targets TRMT10C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30642

  Product name: Recombinant human TRMT10C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-178 aa of NM_017819

  Sequence: MSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEKVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFL

• Full Name: RNA (guanine-9-) methyltransferase domain containing 1
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: NM_017819
• Gene Symbol: TRMT10C
• Gene ID (NCBI): 54931
• RRID: AB_2881239
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L0Y3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

tRNA methyltransferase 10 homolog C (TRMT10C, also known as MRPP1) is involved in mitochondrial RNA processing and modification (PMID: 21593607). It is essential for the 5'-ends processing of mitochondrial tRNAs and plays a critical role in mitochondrial respiration and translation (PMID: 18984158; 29040705). Mutations in TRMT10C may be a cause of mitochondrial disease and highlight the importance of RNA processing for correct mitochondrial function (PMID: 27132592).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cancer Lett; YTHDF3 Drives Tumor Growth and Metastasis by Recruiting eIF4B to Promote Notch2 Translation in Breast Cancer; Authors - Hongyu Chen
human	WB	Cell Death Discov; N1-Methyladenosine modification of mRNA regulates neuronal gene expression and oxygen glucose deprivation/reoxygenation induction; Authors - Zhangyang Qi
mouse	WB	J Biol Chem; RNase P generated tRF(Ser-GCT) promotes fat storage in adipocytes via Adrb2 signaling.; Authors - Linyuan Shen ; KD Validated
	WB,IF	Cell Metab; Liver-breast communication of adipocyte-oriented exosomes drives primary mammary cancer progression; Authors - Chunni Li
mouse	WB	BMC Cardiovasc Disord; Single-cell transcriptomics reveals writers of RNA modification-mediated immune microenvironment and cardiac resident Macro-MYL2 macrophages in heart failure; Authors - Yao-Lin Yang
mouse,human	WB	Phytother Res; Astragaloside IV protects renal tubular epithelial cells against oxidative stress-induced injury by upregulating CPT1A-mediated HSD17B10 lysine succinylation in diabetic kidney disease; Authors - Meng Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Vicente (Verified Customer) (03-16-2026)

In the image of the immunofluorescence the antibody is in the green channel.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: Prostate cancer cell line

TRMT10C Antibody Immunofluorescence validation (1:200 dilution) in Prostate cancer cell line (Cat no:29087-1-AP)

FH

Yan (Verified Customer) (10-23-2025)

Works really well in SDS-PAGE. Tested in primary fibroblasts, BJ-5ta (right) and MCF-7 (left) cells.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: MCF-7 / BJ-5ta

TRMT10C Antibody Western Blot validation (1:1000 dilution) in MCF-7 / BJ-5ta (Cat no:29087-1-AP)