TRMT12 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84167-3-RR (same clone as 84167-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84167-3-RR (TRMT12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84167-3-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 84167-3-RR (same clone as 84167-3-PBS)

  WB result of TRMT12 antibody (84167-3-RR; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRMT12 transfected MCF-7 cells. This data was developed using the same antibody clone with 84167-3-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRMT12 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84167-3-PBS

Clone No.241483H1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

241483H1, EC:2.5.1.114, TRM12, tRNA methyltransferase 12, tRNA wybutosine-synthesizing protein 2 homolog

---

Product Information

84167-3-PBS targets TRMT12 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9258

  Product name: Recombinant human TRMT12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 99-448 aa of BC011713

  Sequence: QGCSPAQKLCLEVSRWVEGRGVKWSAELEADLPRSWQRHGNLLLLSEDCFQAKQWKNLGPELWETVALALGVQRLAKRGRVSPDGTRTPAVTLLLGDHGWVEHVDNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEINGVADRCQIHFGDNRKLKLSNIADRVILGLIPSSEEGWPIACQVLRQDAGGILHIHQNVESFPGKNLQALGVSKVEKEHWLYPQQITTNQWKNGATRDSRGKMLSPATKPEWQRWAESAETRIATLLQQVHGKPWKTQILHIQPVKSYAPHVDHIVLDLECCPCPSVG

• Full Name: tRNA methyltransferase 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 448 aa, 50 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC011713
• Gene Symbol: TRMT12
• Gene ID (NCBI): 55039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q53H54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.