TRP2/DCT Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TRP2/DCT Recombinant monoclonal antibody, PBS Only (88100-1-PBS)

TRP2/DCT Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88100-1-PBS

Clone No.260396B12

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, monkey

Applications

WB, Indirect ELISA

Synonyms

DCT, DT, EC:5.3.3.12, L-dopachrome Delta-isomerase, L-dopachrome tautomerase

• 

  WB analysis using 88100-1-RR (same clone as 88100-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88100-1-RR (DCT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88100-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 88100-1-RR (same clone as 88100-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88100-1-RR (DCT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88100-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88100-1-PBS targets TRP2/DCT in WB, Indirect ELISA applications and shows reactivity with human, rat, monkey samples.

• Tested Reactivity: human, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26165

  Product name: Recombinant human DCT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC028311

  Sequence: MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA

• Full Name: dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2)
• Calculated Molecular Weight: 519 aa, 59 kDa
• Observed Molecular Weight: 59-63 kDa
• GenBank Accession Number: BC028311
• Gene Symbol: DCT
• Gene ID (NCBI): 1638
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40126
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCT (L-dopachrome Delta-isomerase) is also named as TYRP2,TRP2 and belongs to the tyrosinase family. Human TYRP2 protein has 83% identity and 90% similarity to the mouse sequence and has all the structural characteristics of the tyrosinase protein family, including a signal peptide, 15 conserved cysteine residues, 2 copper-binding domains, and a C-terminal membrane-spanning region (PMID:8206391). TYRP2 is involved in neural progenitor cell proliferation and has been implicated in drug and radiation resistance in malignant melanoma. Mutations in DCT cause oculocutaneous albinism type VIII (OCA8), and TYRP2 serves as both an early melanoblast marker and a melanoma-associated antigen with clinical relevance as a potential biomarker in immune checkpoint therapy.