TRPC5 Polyclonal antibody

• 

  WB analysis using 25890-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25890-1-AP (TRPC5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 25890-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25890-1-AP (TRPC5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 25890-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25890-1-AP (TRPC5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 25890-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 25890-1-AP (TRPC5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 25890-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25890-1-AP (TRPC5 Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 25890-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25890-1-AP (TRPC5 Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cerebellum using 25890-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 25890-1-AP (TRPC5 Antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human cerebellum using 25890-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 25890-1-AP (TRPC5 Antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of SH-SY5Y using 25890-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using TRPC5 antibody (25890-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

TRPC5 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25890-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

hTRP 5, hTRP5, hTRP-5, Transient receptor protein 5, TRP 5

---

Tested Applications

• Positive WB detected in: HL-60 cells, MCF-7 cells
• Positive IHC detected in: human brain tissue, human cerebellum tissue, mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 12 publications below
• IHC: See 1 publications below
• IF: See 5 publications below

Product Information

25890-1-AP targets TRPC5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23171

  Product name: Recombinant human TRPC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 756-973 aa of BC137271

  Sequence: EVLDLLGNRKHPRSFSTSSTELSQRDDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGPSLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEINLSEVELGEVQGAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHKWGDGQEEQVTTRL

• Full Name: transient receptor potential cation channel, subfamily C, member 5
• Calculated Molecular Weight: 111 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC137271
• Gene Symbol: TRPC5
• Gene ID (NCBI): 7224
• RRID: AB_2880285
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UL62
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Short transient receptor potential channel 5(TRPC5), which belongs to TRPC5 sub-subfamily of transient receptor (TC 1.A.4) family, thought to form a receptor-activated non-selective calcium permeant cation channel, and probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. TRPC5 has also been shown to be calcium-selective and may also be activated by intracellular calcium store depletion.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Acta Pharmacol Sin; Endothelial cell Orai1 is essential for endothelium-dependent contraction of mouse carotid arteries in normotensive and hypertensive mice; Authors - Xiao Li
human	WB	Cancer Lett; TRPC3 promotes tumorigenesis of gastric cancer via the CNB2/GSK3β/NFATc2 signaling pathway.; Authors - Da-Cen Lin
human	WB	Elife; Structural basis for human TRPC5 channel inhibition by two distinct inhibitors.; Authors - Kangcheng Song
mouse	WB,IF	J Neuroinflammation; Upregulation of TRPC5 in hippocampal excitatory synapses improves memory impairment associated with neuroinflammation in microglia knockout IL-10 mice.; Authors - Shiji Huo
human	WB	J Mol Cell Cardiol; TRPV6 protects ER stress-induced apoptosis via ATF6α-TRPV6-JNK pathway in human embryonic stem cell-derived cardiomyocytes.; Authors - Zhichao Li
mouse	IF	Biochem Pharmacol; Endothelial cell transient receptor potential channel C5 (TRPC5) is essential for endothelium-dependent contraction in mouse carotid arteries.; Authors - Cai Liang