TRPC5 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TRPC5 Recombinant monoclonal antibody (87978-1-RR)

• 

  WB analysis using 87978-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87978-1-RR (TRPC5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of rat brain using 87978-1-RR

  IP result of anti-TRPC5 (IP:87978-1-RR, 4ug; Detection:87978-1-RR 1:800) with rat brain tissue lysate 1720 ug.

TRPC5 Uni-rAb^® Recombinant Antibody for WB, IP, ELISA

Cat No. 87978-1-RR

Clone No.260014C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IP, ELISA

Synonyms

hTRP 5, hTRP5, hTRP-5, Transient receptor protein 5, TRP 5

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, mouse cerebellum tissue, rat cerebellum tissue, pig brain tissue, fetal human brain tissue
• Positive IP detected in: rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87978-1-RR targets TRPC5 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23271

  Product name: Recombinant human TRPC5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 756-973 aa of BC137271

  Sequence: EVLDLLGNRKHPRSFSTSSTELSQRDDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGPSLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEINLSEVELGEVQGAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHKWGDGQEEQVTTRL

• Full Name: transient receptor potential cation channel, subfamily C, member 5
• Calculated Molecular Weight: 111 kDa
• Observed Molecular Weight: 100-111 kDa
• GenBank Accession Number: BC137271
• Gene Symbol: TRPC5
• Gene ID (NCBI): 7224
• RRID: AB_3745843
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UL62
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Short transient receptor potential channel 5 (TRPC5) is abundantly expressed in hippocampal neurons (PMID: 9553080). TRPC5 channels participate in a variety of physiological and pathophysiological processes, covering vascular smooth muscle activity, endothelial function, adiponectin modulation, oxidative stress, epilepsy, anxiety, pain sensation, as well as cardiac remodeling (PMID: 15538613; 22668831; 16685599; 26069213).