TRPT1 Polyclonal antibody

• 

  IHC staining of human liver cancer using 15541-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15541-1-AP (TRPT1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 15541-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15541-1-AP (TRPT1 Antibody) at dilution of 1:50 (under 40x lens).

TRPT1 Polyclonal Antibody for IHC, ELISA

Cat No. 15541-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

tRNA 2 phosphotransferase 1, tRNA phosphotransferase 1, TRPT1

---

Tested Applications

• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

15541-1-AP targets TRPT1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7897

  Product name: Recombinant human TRPT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-204 aa of BC005133

  Sequence: MGADGFVPLGTLLQLPQFRGFSAEDVQRVVDTNRKQRFALQLGDPSTGLLIRANQGHSLQVPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLALADGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTRKPLSLAGDEETECQSSPKHSSRERRRIQQ

• Full Name: tRNA phosphotransferase 1
• Calculated Molecular Weight: 28 kDa
• GenBank Accession Number: BC005133
• Gene Symbol: TRPT1
• Gene ID (NCBI): 83707
• RRID: AB_2878149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86TN4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRPT1 catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate. It has four isoforms with MW 22-24 and 27-29 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Int J Mol Sci; Impaired 26S Proteasome Assembly Precedes Neuronal Loss in Mutant UBQLN2 Rats.; Authors - Wenjuan Zhang