TRPV2 Polyclonal antibody

• 

  WB analysis using 15991-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15991-1-AP (TRPV2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

TRPV2 Polyclonal Antibody for WB, ELISA

Cat No. 15991-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Osm 9 like TRP channel 2, OTRPC2, TRPV2, VRL, VRL 1, VRL1

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

15991-1-AP targets TRPV2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8864

  Product name: Recombinant human TRPV2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC018926

  Sequence: MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEE

• Full Name: transient receptor potential cation channel, subfamily V, member 2
• Calculated Molecular Weight: 764 aa, 86 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC018926
• Gene Symbol: TRPV2
• Gene ID (NCBI): 51393
• RRID: AB_3085477
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5S1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transient receptor potential vanilloid 2 (TRPV2), also name as VRL-1, plays a critical role in neuronal development, cardiac function, immunity, and cancer (PMID: 31566564). It has been found to play an essential role in sustained intracellular Ca2+ concentration increase (PMID: 31857697). It's reported that TRPV2 is activated by high temperatures, with a threshold of around 52℃ (PMID: 10201375). The calculated molecular of TRPV2 is 86 kDa, 15991-1-AP can detect the band around 90 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO Mol Med; Tranilast directly targets NLRP3 to treat inflammasome-driven diseases.; Authors - Yi Huang
	WB	Stem Cell Res; Establishment of a TRPV2 knockout human embryonic stem cell line (WAe009-A-1Y) using episomal vector-based CRISPR/Cas9; Authors - Rui Bai ; KD Validated