TRPV2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HT-1080 using 83022-1-RR (same clone as 83022-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 83022-1-RR (TRPV2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83022-1-PBS in a different storage buffer formulation.

• 

  FC experiment of K562 using 83022-1-RR (same clone as 83022-1-PBS)

  1x10^6 K562 were intracellularly stained with 0.2 ug TRPV2 Recombinant antibody (83022-1-RR, Clone:230141C3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.2 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83022-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 83022-1-RR (same clone as 83022-1-PBS)

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.25 ug TRPV2 Recombinant antibody (83022-1-RR, Clone:230141C3) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83022-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83022-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83022-1-RR against Human TRPV2 were performed. The affinity constant is 31.3 pM.

TRPV2 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 83022-1-PBS

Clone No.230141C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

230141C3, Osm 9 like TRP channel 2, Osm-9-like TRP channel 2, OTRPC2, Vanilloid receptor-like protein 1

---

Product Information

83022-1-PBS targets TRPV2 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8864

  Product name: Recombinant human TRPV2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC018926

  Sequence: MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEE

• Full Name: transient receptor potential cation channel, subfamily V, member 2
• Calculated Molecular Weight: 764 aa, 86 kDa
• Observed Molecular Weight: ~80 kDa
• GenBank Accession Number: BC018926
• Gene Symbol: TRPV2
• Gene ID (NCBI): 51393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5S1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transient receptor potential vanilloid 2 (TRPV2), also name as VRL-1, plays a critical role in neuronal development, cardiac function, immunity, and cancer (PMID: 31566564). It has been found to play an essential role in sustained intracellular Ca2+ concentration increase (PMID: 31857697). It's reported that TRPV2 is activated by high temperatures, with a threshold of around 52℃ (PMID: 10201375).