Product Information
29971-1-PBS targets TRPV3 in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32437 Product name: Recombinant human TRPV3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 671-790 aa of NM_001258205 Sequence: NMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV Predict reactive species |
| Full Name | transient receptor potential cation channel, subfamily V, member 3 |
| Calculated Molecular Weight | 91kd |
| GenBank Accession Number | NM_001258205 |
| Gene Symbol | TRPV3 |
| Gene ID (NCBI) | 162514 |
| RRID | AB_3086200 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NET8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Transient receptor potential cation channel, subfamily V, member 3, also known as TRPV3, is a human gene encoding the protein of the same name. The TRPV3 protein belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of human sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. The TRPV3 channel has wide tissue expression that is especially high in the skin (keratinocytes) but also in the brain. It functions as a molecular sensor for innocuous warm temperatures.( PMID 12016205)
